Syverson paul (22 Ergebnisse)

PAP. Zustand: New. New Book. Shipped from UK. Established seller since 2000.

PAP. Zustand: New. New Book. Shipped from UK. Established seller since 2000.

Paperback. Zustand: Very Good. Very good paperback. Pages are clean and unmarked. Covers show minor shelf wear, may have minor rubbing and scuffing. Sticker residue on front and back cover.; 100% Satisfaction Guaranteed! Ships same or next business day.

Paperback. Zustand: Brand New. 1st edition. 166 pages. 9.15x6.25x0.30 inches. In Stock.

Zustand: New.

Zustand: Good. 1st Edition. Pages intact with minimal writing/highlighting. The binding may be loose and creased. Dust jackets/supplements are not included. Stock photo provided. Product includes identifying sticker. Better World Books: Buy Books. Do Good.

HRD. Zustand: New. New Book. Shipped from UK. Established seller since 2000.

HRD. Zustand: New. New Book. Shipped from UK. Established seller since 2000.

Hardcover. Zustand: Brand New. 2nd edition. 140 pages. 9.50x6.25x0.45 inches. In Stock.

Zustand: New. Series: Lecture Notes. Num Pages: 144 pages, Illustrations. BIC Classification: HPL. Category: (P) Professional & Vocational. Dimension: 237 x 162 x 15. Weight in Grams: 358. . 2003. 2. Hardback. . . . . Books ship from the US and Ireland.

Zustand: New. In English.

Zustand: New. In English.

Zustand: New. In English.

Zustand: New. In English.

Zustand: New. &Uumlber den AutorPaul F. Syverson is a mathematician at the Center for High Assurance Computer Systems within the Naval Research Laboratory.

Soft cover. Zustand: Near Fine. Softcover 2005 edition. Covers and text in near fine condition. Binding firm. Pages unmarked and clean. Name to top of title page [408 pages].

Softcover. Zustand: Gut. Gebraucht - Gut Verlagsmängelex., VIII, 239 p. Also available online. Brosch This book constitutes the thoroughly refereed post-proceedings of the Second International Workshop on Privacy Enhancing Technologies, PET 2002, held in San Francisco, CA, USA, in April 2002. The 17 revised full papers presented were carefully selected during two rounds of reviewing and improvement. Among the topics addressed are Internet security, private authentication, information theoretic anonymity, anonymity measuring, enterprise privacy practices, service architectures for privacy, intersection attacks, online trust negotiation, random data perturbation, Website fingerprinting, Web user privacy, TCP timestamps, private information retrieval, and unobservable Web surfing.…

Taschenbuch. Zustand: Neu. Druck auf Anfrage Neuware - Printed after ordering - Privacy-Enhancing Technologies for the Internet, II: Five Years Later.- Detecting Web Bugs with Bugnosis: Privacy Advocacy through Education.- Private Authentication.- Towards an Information Theoretic Metric for Anonymity.- Towards Measuring Anonymity.- Platform for Enterprise Privacy Practices: Privacy-Enabled Management of Customer Data.- Privacy Enhancing Profile Disclosure.- Privacy Enhancing Service Architectures.- Dummy Traffic against Long Term Intersection Attacks.- Protecting Privacy during On-Line Trust Negotiation.- Prototyping an Armored Data Vault.- Preventing Interval-Based Inference by Random Data Perturbation.- Fingerprinting Websites Using Traffic Analysis.- A Passive Attack on the Privacy of Web Users Using Standard Log Information.- Covert Messaging through TCP Timestamps.- Almost Optimal Private Information Retrieval.- Unobservable Surfing on the World Wide Web: Is Private Information Retrieval an Alternative to the MIX Based Approach .…

Zustand: New.

Zustand: New. &Uumlber den AutorPaul F. Syverson is a mathematician at the Center for High Assurance Computer Systems within the Naval Research Laboratory.

Taschenbuch. Zustand: Neu. Druck auf Anfrage Neuware - Printed after ordering - The fthFinancialCryptographyconferencewasheldFebruary19 22,2001. Afterhalfadecade,wemovedbeyondourAnguillanoriginstoGrandCayman, BWI. Thevenuechangedbutthefocusoftheprogramremainedtopresentthe bestresearchinsecuringelectronic nancialtransactionsandelectronicc- merce. Asinthepastfewyears,mostofthecontributedpapersfocusedonthe technicalcryptographicandsecurityaspectsof nancialcryptography,whilethe nancialaspectsarere ectedprimarilyininvitedtalksandpanels. (Andinthe informaldiscussion. )Thisyear,inadditiontothesubmittedpapers,wehada provocativeinvitedtalkbyRichardRahnonmoneylaunderingaswellaspanels ondigitalrightsmanagementandthebusinessofelectronicvoting. Therewas alsoarumpsession,chairedbyRebeccaWright. Thereweremanyinterestingandmanytechnicallystrongsubmissions. I thanktheprogramcommittee(listedonthenextpage)fortheirhelpinthe di culttaskofchoosingthosepapersthatmadethestrongestcontributionto theconference. WehadadditionalreviewinghelpfromOlivierBaudron,Paul Fahn,JuanGaray,MarkusJakobsson,GuenterKarjoth,PhongNguyen,David Pointcheval,ThomasPornin,SholomRosen,DawnSong,SusanneWetzel,and RebeccaWright. (MyapologiesifIhaveoverlookedanyone. )Iwouldalsoliketo thankGeorgeDavida,theelectronicsubmissionschair,andhisstudent,Dawn MarieGibson,forsettingupandrunningthesubmissionsprocessattheUniv- sityofWisconsin. AnextrabigthankyoutoYairFrankel,whowasalwaysthere withhisexperienceandadvicethatgreatlyimprovedthejobIdidasprogram chair,aswellasmakingitmoreenjoyable. MattFranklinalsoprovidedvaluable advice. Thankstoallthepeoplewhosubmittedpapers,withoutwhichthere wouldbenoprogram. Authorsweregiventheopportunitytorevisetheirpapers followingtheconference. Thesewerecollectedwithoutfurtherreviewandare includedinthisvolume. ThankstogeneralchairStuartHaberfordoingmanythingsthatnoneofthe attendeesnoticedbecausehedidthemsonicely. HewasablyassistedbyHinde tenBerge. ThankstoHarrisMcCoyforhandlinglocalarrangementsandJason CronkformaintainingtheWebsite. ThankstotheIFCAdirectorsforkeeping FCthriving,toAdamShostackforvenuearrangements,andtoBarbFox,the sponsorshipchair. Thankstoour nancialsponsors,whoarelistedonthenext page. SpecialthankstoRayHirschfeldwhoseadvicetomeandtotheothersm- tionedherehasbeeninvaluable. Thanks nallytoattendeeswithoutwhomthere wouldbenoconference. March2001 PaulSyverson VI Preface ProgramCommittee MattBlaze,AT&TLabs-Research YairFrankel,Ecash MattFranklin,UCDavis DavidKravitz,WaveSystemsCorp. ArjenLenstra,Citicorp PhilipMacKenzie,LucentBellLabs AviRubin,AT&TLabs-Research JacquesStern,EcoleNormaleSup erieure KazueSako,NEC StuartStubblebine,CertCo PaulSyverson(Chair),NavalResearchLab WinTreese,OpenMarket,Inc. DougTygar,UCBerkeley MichaelWaidner,IBMZurichResearchLab MotiYung,CertCo GeneralChair StuartHaber,Intertrust SponsorshipChair BarbFox,Microsoft FinancialCryptography2001wasorganizedbytheInternationalFinancialCr- tographyAssociation(IFCA),andwassponsoredbyBibitInternetPayments, CertCo,Certicom,HushCommunications,IBM,InterTrustSTARLab,- crosoft,nCipher,RSASecurity,andZero-KnowledgeSystems. TableofContents ManagingPaymentTransactionCosts AmortizedE-Cash . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1 MosesLiskov,SilvioMicali O ineMicropaymentswithoutTrustedHardware. . . . . . . . . . . . . . . . . . . . . . 21 MattBlaze,JohnIoannidis,AngelosD. Keromytis Panel(I) ThePracticalProblemsofImplementingMicroMint. . . . . . . . . . . . . . . . . . . . 41 NickovanSomeren ProtectingDigitalRights . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 51 YairFrankel AspectsofDigitalRightsManagementandtheUseofHardwareSecurity Devices. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 54 DavidW. Kravitz ASolutiontotheNapsterPhenomenon:WhyValueCannotBeCreated AbsenttheTransferofSubjectiveData. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 59 ScottMoskowitz GoldenTimesforDigitalRightsMan.…

Taschenbuch. Zustand: Neu. Neuware - Foreword from the Program Chairs These proceedings contain the papers selected for presentation at the 10th - ropean Symposium on Research in Computer Security (ESORICS), held S- tember 12-14, 2005 in Milan, Italy. In response to the call for papers 159 papers were submitted to the conf- ence. These paperswere evaluated on the basis of their signi cance, novelty,and technical quality. Each paper was reviewed by at least three members of the program committee. The program committee meeting was held electronically, holding intensive discussion over a period of two weeks. Of the papers subm- ted, 27 were selected for presentation at the conference, giving an acceptance rate of about 16%. The conference program also includes an invited talk by Barbara Simons. There is a long list of people who volunteered their time and energy to put together the symposiom and who deserve acknowledgment. Thanks to all the members of the program committee, and the external reviewers, for all their hard workin evaluating and discussing papers. We are also very grateful to all those people whose work ensured a smooth organizational process: Pierangela Samarati, who served as General Chair, Claudio Ardagna, who served as P- licity Chair, Dieter Gollmann who served as Publication Chair and collated this volume, and Emilia Rosti and Olga Scotti for helping with local arrangements. Last, but certainly not least, our thanks go to all the authors who submitted papers and all the attendees. We hope you nd the program stimulating.…